PDB entry 3mw1

View 3mw1 on RCSB PDB site
Description: p38 kinase Crystal structure in complex with small molecule inhibitor
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: p38 MAP KINASE, TRANSFERASE, INHIBITOR COMPLEX, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2010-05-05, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.259
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: Mapk14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw1a_
  • Heterogens: MIH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mw1A (A:)
    sqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqs
    iihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqk
    ltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtg
    yvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgt
    pgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaq
    alahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw1A (A:)
    erptfyrqelnktiwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrt
    yrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglatddemtgyvatrwyra
    peimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkki
    ssesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaq
    yhdpddepvadpydqsfesrdllidewksltydevisfvppp