PDB entry 3mw0

View 3mw0 on RCSB PDB site
Description: X-ray structure of the doubly hydroxylated iron complex-NikA species, NikA1/O2
Class: transport protein
Keywords: protein-bound iron complex, TRANSPORT PROTEIN
Deposited on 2010-05-05, released 2011-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.178
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nickel-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: NIKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw0a_
  • Chain 'B':
    Compound: Nickel-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: NIKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw0b_
  • Heterogens: FE, BHR, DTD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mw0A (A:)
    aapdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedg
    ktwtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqi
    tlksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvr
    nenywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayht
    qlsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpy
    anlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeii
    qadmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfq
    aqqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpel
    gnipyapiateipfeqikpvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw0A (A:)
    apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
    twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
    lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
    enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
    lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
    nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
    admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
    qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
    nipyapiateipfeqikp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mw0B (B:)
    aapdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedg
    ktwtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqi
    tlksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvr
    nenywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayht
    qlsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpy
    anlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeii
    qadmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfq
    aqqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpel
    gnipyapiateipfeqikpvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw0B (B:)
    pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
    wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
    ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
    nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
    sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
    lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
    dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
    qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
    ipyapiateipfeqikp