PDB entry 3mvu

View 3mvu on RCSB PDB site
Description: Crystal structure of a TenA family transcription regulator (TM1040_3656) from SILICIBACTER SP. TM1040 at 1.80 A resolution
Class: transcription regulator
Keywords: TENA/THI-4/PQQC family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, TRANSCRIPTION, transcription regulator
Deposited on 2010-05-04, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TenA family transcriptional regulator
    Species: Ruegeria sp. TM1040 [TaxId:292414]
    Gene: TM1040_3656
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvua_
  • Heterogens: IMD, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mvuA (A:)
    gmsepygkafslmraeaepawraythhafveglkagtlpreaflhylqqdyvflihfsra
    walavvksethsemlaavgtvnalvaeemqlhigiceasgisqealfatreraenlaytr
    fvleagysgdlldllaalapcvmgygeigkrltaeatstlygdwidtyggddyqaackav
    gtllddalerrlgaeftssprwsrlcqtfhtatelevgfwqmgltp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvuA (A:)
    msepygkafslmraeaepawraythhafveglkagtlpreaflhylqqdyvflihfsraw
    alavvksethsemlaavgtvnalvaeemqlhigiceasgisqealfatreraenlaytrf
    vleagysgdlldllaalapcvmgygeigkrltaeatstlygdwidtyggddyqaackavg
    tllddalerrlgaeftssprwsrlcqtfhtatelevgfwqmgltp