PDB entry 3mvs

View 3mvs on RCSB PDB site
Description: Structure of the N-terminus of Cadherin 23
Deposited on 2010-05-04, released 2010-06-09
The last revision was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.164
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cadherin-23
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh23
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mvsA (A:)
    qvnrlpfftnhffdtyllisedtpvgssvtqllardmdndplvfgvsgeeasrffavepd
    tgvvwlrqpldretkseftvefsvsdhqgvitrkvniqvgdvndnaptfhnqpysvripe
    ntpvgtpifivnatdpdlgaggsvlysfqppspffaidsargivtviqeldyevtqayql
    tvnatdqdktrplstlanlaiiitdmqdmd