PDB entry 3mvr

View 3mvr on RCSB PDB site
Description: Crystal Structure of cytochrome P450 2B4-H226Y in a closed conformation
Class: oxidoreductase
Keywords: Ligand free closed conformation, P450, Cytochrome P450 2B4, monooxygenase, oxidoreductase, membrane protein, CYP 2B4.
Deposited on 2010-05-04, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2B4
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: CYP2B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00178 (Start-471)
      • engineered (9)
      • engineered (201)
      • engineered (206)
      • expression tag (472)
    Domains in SCOPe 2.07: d3mvra1, d3mvra2
  • Chain 'B':
    Compound: Cytochrome P450 2B4
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: CYP2B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00178 (Start-471)
      • engineered (9)
      • engineered (201)
      • engineered (206)
      • expression tag (472)
    Domains in SCOPe 2.07: d3mvrb1, d3mvrb2
  • Heterogens: HEM, CM5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mvrA (A:)
    makktsskgklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlc
    gtdairealvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgk
    rsveeriqeearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrll
    dlffqsfslissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldps
    nprdfidvyllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyph
    vtervqkeieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrg
    yvipkntevfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclge
    giartelflffttilqnfsiaspvppedidltpresgvgnvppsyqirflarhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvrA (A:)
    gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
    lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
    eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
    lissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
    yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
    ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
    vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
    lffttilqnfsiaspvppedidltpsgvgnvppsyqirflarh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mvrB (B:)
    makktsskgklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlc
    gtdairealvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgk
    rsveeriqeearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrll
    dlffqsfslissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldps
    nprdfidvyllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyph
    vtervqkeieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrg
    yvipkntevfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclge
    giartelflffttilqnfsiaspvppedidltpresgvgnvppsyqirflarhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvrB (B:)
    gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
    lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
    eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
    lissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
    yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
    ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
    vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
    lffttilqnfsiaspvppedidltpsgvgnvppsyqirflarh