PDB entry 3mvq

View 3mvq on RCSB PDB site
Description: Bovine Glutamate dehydrogenase complexed with zinc
Class: oxidoreductase
Keywords: bovine glutamate dehydrogenase, inhibition, OXIDOREDUCTASE
Deposited on 2010-05-04, released 2011-05-04
Made obsolete by 6dhl on 2018-07-25

The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.225
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvqa1, d3mvqa2
  • Chain 'B':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvqb1, d3mvqb2
  • Chain 'C':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvqc1, d3mvqc2
  • Chain 'D':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvqd1, d3mvqd2
  • Chain 'E':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvqe1, d3mvqe2
  • Chain 'F':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvqf1, d3mvqf2
  • Heterogens: GLU, NDP, GTP, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mvqA (A:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvqA (A:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mvqB (B:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvqB (B:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mvqC (C:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvqC (C:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mvqD (D:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvqD (D:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mvqE (E:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvqE (E:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mvqF (F:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft