PDB entry 3mvo

View 3mvo on RCSB PDB site
Description: crystal structure of bovine glutamate dehydrogenase complexed with eu3+
Deposited on 2010-05-04, released 2011-05-04
Made obsolete by 6dhn on 2018-07-25

The last revision was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 3.23 Å
R-factor: 0.263
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GLU, NDP, EU3

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mvoA (A:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records):
    >3mvoA (A:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mvoB (B:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records):
    >3mvoB (B:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mvoC (C:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records):
    >3mvoC (C:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mvoD (D:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records):
    >3mvoD (D:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mvoE (E:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records):
    >3mvoE (E:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mvoF (F:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records):
    >3mvoF (F:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne