PDB entry 3mvn

View 3mvn on RCSB PDB site
Description: crystal structure of a domain from a putative udp-n-acetylmuramate:l- alanyl-gamma-d-glutamyl-medo-diaminopimelate ligase from haemophilus ducreyi 35000hp
Deposited on 2010-05-04, released 2010-06-16
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-medo-diaminopimelate ligase
    Species: Haemophilus ducreyi [TaxId:233412]
    Gene: HD_0703, mpl
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mvnA (A:)
    mhhhhhhssgvdlgtenlyfqsnaqrrlevkgvvnnitvyddfahhptaitatidalrak
    vgqqrilavleprsntmkmgvhkhelatslqdadsvfiyqpptiewqvsevlanlaqpai
    saddvdelvmrivqqakpndhilimsngafggihqklltalan
    

    Sequence, based on observed residues (ATOM records):
    >3mvnA (A:)
    rlevkgvvnnitvyddfahhptaitatidalrakvgqqrilavleprkhelatslqdads
    vfiyqpwqvsevlanlaqpaisaddvdelvmrivqqakpndhilimsngafggihqkllt
    ala