PDB entry 3mvm

View 3mvm on RCSB PDB site
Description: P38 Alpha Map Kinase complexed with pyrrolotriazine inhibitor 7V
Class: transferase/transferase inhibitor
Keywords: SERINE/THREONINE-PROTEIN KINASE, KINASE, TRANSFERASE, P38 MAP KINASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-05-04, released 2010-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mvma_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mvmb_
  • Heterogens: 39P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mvmA (A:)
    mahhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvmA (A:)
    erptfyrqelnktiwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrt
    yrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhttrwyrapeimlnw
    mhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarn
    yiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpdde
    pvadpydqsfesrdllidewksltydevisfvppp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mvmB (B:)
    mahhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvmB (B:)
    rptfyrqelnktiwevperyqnlspvygsvcaafdtktglrvavkklsrpfqsiihakrt
    yrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglartrwyrapeimlnwmh
    ynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyi
    qsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepv
    adpydqsfesrdllidewksltydevisfvpp