PDB entry 3mvk

View 3mvk on RCSB PDB site
Description: The Crystal Structure of FucU from Bifidobacterium longum to 1.65A
Class: isomerase
Keywords: PSI, MCSG, Structural Genomics, Midwest Center for Structural Genomics, Protein Structure Initiative, ISOMERASE
Deposited on 2010-05-04, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein FucU
    Species: Bifidobacterium longum subsp. infantis [TaxId:391904]
    Gene: Blon_2305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvka_
  • Chain 'B':
    Compound: protein FucU
    Species: Bifidobacterium longum subsp. infantis [TaxId:391904]
    Gene: Blon_2305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvkb_
  • Chain 'C':
    Compound: protein FucU
    Species: Bifidobacterium longum subsp. infantis [TaxId:391904]
    Gene: Blon_2305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvkc_
  • Chain 'D':
    Compound: protein FucU
    Species: Bifidobacterium longum subsp. infantis [TaxId:391904]
    Gene: Blon_2305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvkd_
  • Chain 'E':
    Compound: protein FucU
    Species: Bifidobacterium longum subsp. infantis [TaxId:391904]
    Gene: Blon_2305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvke_
  • Chain 'F':
    Compound: protein FucU
    Species: Bifidobacterium longum subsp. infantis [TaxId:391904]
    Gene: Blon_2305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvkf_
  • Chain 'G':
    Compound: protein FucU
    Species: Bifidobacterium longum subsp. infantis [TaxId:391904]
    Gene: Blon_2305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvkg_
  • Chain 'H':
    Compound: protein FucU
    Species: Bifidobacterium longum subsp. infantis [TaxId:391904]
    Gene: Blon_2305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvkh_
  • Chain 'I':
    Compound: protein FucU
    Species: Bifidobacterium longum subsp. infantis [TaxId:391904]
    Gene: Blon_2305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvki_
  • Chain 'J':
    Compound: protein FucU
    Species: Bifidobacterium longum subsp. infantis [TaxId:391904]
    Gene: Blon_2305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvkj_
  • Heterogens: NA, PGE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mvkA (A:)
    mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkail
    tvfpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqak
    naycviasgesaqyanlilqkgvvfnae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvkA (A:)
    ipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfp
    ldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqaknayc
    viasgesaqyanlilqkgvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mvkB (B:)
    mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkail
    tvfpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqak
    naycviasgesaqyanlilqkgvvfnae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvkB (B:)
    ipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfp
    ldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqaknayc
    viasgesaqyanlilqkgvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mvkC (C:)
    mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkail
    tvfpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqak
    naycviasgesaqyanlilqkgvvfnae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvkC (C:)
    ipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfp
    ldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqaknayc
    viasgesaqyanlilqkgvvf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mvkD (D:)
    mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkail
    tvfpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqak
    naycviasgesaqyanlilqkgvvfnae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvkD (D:)
    ipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfp
    ldtyvdkpatlmekvpgdvatpiwdvyaglikehdergadaigslerfafyeqaknaycv
    iasgesaqyanlilqkgvvf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mvkE (E:)
    mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkail
    tvfpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqak
    naycviasgesaqyanlilqkgvvfnae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvkE (E:)
    ipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfp
    ldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqaknayc
    viasgesaqyanlilqkgvvf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mvkF (F:)
    mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkail
    tvfpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqak
    naycviasgesaqyanlilqkgvvfnae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvkF (F:)
    ipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfp
    ldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqaknayc
    viasgesaqyanlilqkgvv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mvkG (G:)
    mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkail
    tvfpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqak
    naycviasgesaqyanlilqkgvvfnae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvkG (G:)
    kgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtv
    fpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqakna
    ycviasgesaqyanlilqkgvvf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mvkH (H:)
    mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkail
    tvfpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqak
    naycviasgesaqyanlilqkgvvfnae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvkH (H:)
    ipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfp
    ldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqaknayc
    viasgesaqyanlilqkgvvf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3mvkI (I:)
    mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkail
    tvfpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqak
    naycviasgesaqyanlilqkgvvfnae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvkI (I:)
    ipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfp
    ldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqaknayc
    viasgesaqyanlilqkgvvf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3mvkJ (J:)
    mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkail
    tvfpldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqak
    naycviasgesaqyanlilqkgvvfnae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvkJ (J:)
    ipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfp
    ldtyvdkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqaknayc
    viasgesaqyanlilqkgvvf