PDB entry 3mvj

View 3mvj on RCSB PDB site
Description: Human cyclic AMP-dependent protein kinase PKA inhibitor complex
Class: transferase
Keywords: kinase inhibitor, TRANSFERASE
Deposited on 2010-05-04, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PKA, PKACA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvja_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PKA, PKACA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvjb_
  • Chain 'E':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PKA, PKACA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvje_
  • Chain 'I':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Database cross-references and differences (RAF-indexed):
  • Heterogens: XFE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mvjA (A:)
    mgsshhhhhhssglvprgshmgnaaaakkgseqesvkeflakakedflkkwespaqntah
    ldqferiktlgtgsfgrvmlvkhketgnhyamkildkqkvvklkqiehtlnekrilqavn
    fpflvklefsfkdnsnlymvmeyvpggemfshlrrigrfsepharfyaaqivltfeylhs
    ldliyrdlkpenllidqqgyiqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkav
    dwwalgvliyemaagyppffadqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltk
    rfgnlkngvndiknhkwfattdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsi
    nekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvjA (A:)
    vkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mvjB (B:)
    mgsshhhhhhssglvprgshmgnaaaakkgseqesvkeflakakedflkkwespaqntah
    ldqferiktlgtgsfgrvmlvkhketgnhyamkildkqkvvklkqiehtlnekrilqavn
    fpflvklefsfkdnsnlymvmeyvpggemfshlrrigrfsepharfyaaqivltfeylhs
    ldliyrdlkpenllidqqgyiqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkav
    dwwalgvliyemaagyppffadqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltk
    rfgnlkngvndiknhkwfattdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsi
    nekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvjB (B:)
    vkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf
    ipkeeeirvsinekcgkefsef
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mvjE (E:)
    mgsshhhhhhssglvprgshmgnaaaakkgseqesvkeflakakedflkkwespaqntah
    ldqferiktlgtgsfgrvmlvkhketgnhyamkildkqkvvklkqiehtlnekrilqavn
    fpflvklefsfkdnsnlymvmeyvpggemfshlrrigrfsepharfyaaqivltfeylhs
    ldliyrdlkpenllidqqgyiqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkav
    dwwalgvliyemaagyppffadqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltk
    rfgnlkngvndiknhkwfattdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsi
    nekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvjE (E:)
    vkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.