PDB entry 3mvd

View 3mvd on RCSB PDB site
Description: Crystal structure of the chromatin factor RCC1 in complex with the nucleosome core particle
Class: signaling protein/structural protein/DNA
Keywords: PROTEIN-DNA COMPLEX, NUCLEOSOME CORE PARTICLE (NCP), NCP-chromatin factor complex, 7-bladed beta-propeller, SIGNALING PROTEIN-STRUCTURAL PROTEIN-DNA complex
Deposited on 2010-05-04, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.176
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233
      • see remark 999 (101)
    Domains in SCOPe 2.07: d3mvda_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvdb_
  • Chain 'C':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: LOC494591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvdc_
  • Chain 'D':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281
      • see remark 999 (28)
    Domains in SCOPe 2.07: d3mvdd_
  • Chain 'E':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233
      • see remark 999 (101)
    Domains in SCOPe 2.07: d3mvde_
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvdf_
  • Chain 'G':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: LOC494591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mvdg_
  • Chain 'H':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281
      • see remark 999 (28)
    Domains in SCOPe 2.07: d3mvdh_
  • Chain 'I':
    Compound: DNA (146-mer)
  • Chain 'J':
    Compound: DNA (146-mer)
  • Chain 'K':
    Compound: Regulator of chromosome condensation
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Bj1, CG10480, RCC1 (Bj1)
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Regulator of chromosome condensation
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Bj1, CG10480, RCC1 (Bj1)
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mvdA (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvdA (A:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvalfedtnlcaihakrvtimpkdiqlarrirger
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mvdB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvdB (B:)
    kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
    tvtamdvvyalkrqgrtlygfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mvdC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksaksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvdC (C:)
    akaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaar
    dnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mvdD (D:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvdD (D:)
    trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mvdE (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvdE (E:)
    ryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseay
    lvalfedtnlcaihakrvtimpkdiqlarrirger
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mvdF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvdF (F:)
    rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
    krktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mvdG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksaksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvdG (G:)
    akaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaar
    dnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mvdH (H:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mvdH (H:)
    trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.