PDB entry 3mvc

View 3mvc on RCSB PDB site
Description: High resolution crystal structure of the heme domain of GLB-6 from C. elegans
Deposited on 2010-05-03, released 2010-06-16
The last revision was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.163
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Globin protein 6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: C18C4.9, glb-6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Globin protein 6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: C18C4.9, glb-6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, PR, NO3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mvcA (A:)
    lhltqpqilfvrktwnharnqgalepaisifrnsffknpeirqmimfgtknegherlkkh
    aqlftvlmddlianldspsatvaglreagekhvwptrnqygcpfhahlldqfatamiert
    lewgekkdrtettqrgwtkivlfvteqlkegfqdeqkrarr
    

    Sequence, based on observed residues (ATOM records):
    >3mvcA (A:)
    lhltqpqilfvrktwnharnqgalepaisifrnsffknpeirqmimfgtknegherlkkh
    aqlftvlmddlianldspsatvaglreagekhvwptrnqygcpfhahlldqfatamiert
    lewdrtettqrgwtkivlfvteqlkegfqdeqkrarr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mvcB (B:)
    lhltqpqilfvrktwnharnqgalepaisifrnsffknpeirqmimfgtknegherlkkh
    aqlftvlmddlianldspsatvaglreagekhvwptrnqygcpfhahlldqfatamiert
    lewgekkdrtettqrgwtkivlfvteqlkegfqdeqkrarr
    

    Sequence, based on observed residues (ATOM records):
    >3mvcB (B:)
    lhltqpqilfvrktwnharnqgalepaisifrnsffknpeirqmimfgtknegherlkkh
    aqlftvlmddlianlsatvaglreagekhvwptrnqygcpfhahlldqfatamiertlew
    grtettqrgwtkivlfvteqlkegfqdeqkrarr