PDB entry 3mvb

View 3mvb on RCSB PDB site
Description: crystal structure of a triple rfy mutant of human mterf1 bound to the termination sequence
Deposited on 2010-05-03, released 2010-06-30
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: 5'-d(*ap*tp*tp*ap*cp*cp*gp*gp*gp*cp*tp*cp*tp*gp*cp*cp*ap*tp*cp*tp*tp*a)-3'
  • Chain 'E':
    Compound: 5'-d(*tp*ap*ap*gp*ap*tp*gp*gp*cp*ap*gp*ap*gp*cp*cp*cp*gp*gp*tp*ap*ap*t)-3'
  • Chain 'O':
    Compound: Transcription termination factor, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MTERF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99551 (Start-342)
      • engineered (108)
      • engineered (189)
      • engineered (234)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records:
    >3mvbO (O:)
    ghmlfgvkchntdseplknedllknlltmgvdidmarkrqpgvfhrmitneqdlkmflls
    kgaskeviasiisrypraitrtpenlskrwdlwrkivtsdleivnileaspesffrsnnn
    lnlennikflysvgltrkclcrlltnaprtfsnsldlnkqmveflqaaglslghndpadf
    vrkiifknpailiqstkrvkanieflrstfnlnseellvlicgpgaeildlsndaarrsy
    anikeklfslgcteeevqkfvlsypdviflaekkfndkidclmeenisisqiienprvld
    ssistlksrikelvnagcnlstlnitllswskkryeaklkkls
    

    Sequence, based on observed residues (ATOM records):
    >3mvbO (O:)
    edllknlltmgvdidmarkrqpgvfhrmitneqdlkmfllskgaskeviasiisryprai
    trtpenlskrwdlwrkivtsdleivnileaspesffrsnnnlnlennikflysvgltrkc
    lcrlltnaprtfsnsldlnkqmveflqaaglslghndpadfvrkiifknpailiqstkrv
    kanieflrstfnlnseellvlicgpgaeildlsndaarrsyanikeklfslgcteeevqk
    fvlsypdviflaekkfndkidclmeenisisqiienprvldssistlksrikelvnagcn
    lstlnitllswskkryeaklkkls