PDB entry 3mv5

View 3mv5 on RCSB PDB site
Description: Crystal structure of Akt-1-inhibitor complexes
Class: transferase
Keywords: kinase inhibitor, TRANSFERASE
Deposited on 2010-05-03, released 2010-06-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.205
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: v-akt murine thymoma viral oncogene homolog 1 (AKT1)
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT-1, AKT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2RAM5 (5-End)
      • engineered (334)
    Domains in SCOPe 2.05: d3mv5a_
  • Chain 'C':
    Compound: GSK3-beta peptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3MV5 (0-9)
  • Heterogens: MN, XFE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mv5A (A:)
    gamdprvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtlte
    nrvlqnsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeiv
    saldylhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylap
    evledndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaks
    llsgllkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryf
    deeftaqmititppdqddsmecvdserrphfpqfdysassta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mv5A (A:)
    rvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltenrvlq
    nsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsaldy
    lhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapevled
    ndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksllsgl
    lkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfdeeft
    aqmirphfpqfdysas
    

  • Chain 'C':
    No sequence available.