PDB entry 3mv3

View 3mv3 on RCSB PDB site
Description: crystal structure of a-cop in complex with e-cop
Deposited on 2010-05-03, released 2010-06-16
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coatomer subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RET1, COP1, SEC33, YDL145C, D1578
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53622 (23-324)
      • expression tag (22)
  • Chain 'B':
    Compound: Coatomer subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC28, YIL076W
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Coatomer subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RET1, COP1, SEC33, YDL145C, D1578
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53622 (23-324)
      • expression tag (22)
  • Chain 'D':
    Compound: Coatomer subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC28, YIL076W
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Coatomer subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RET1, COP1, SEC33, YDL145C, D1578
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53622 (23-324)
      • expression tag (22)
  • Chain 'F':
    Compound: Coatomer subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC28, YIL076W
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mv3A (A:)
    mgsshhhhhhssglevlfqgphmetaiwiknsklpavlvaagafdaavqalskqvgvvkl
    eplkkyftniyegcrtyipstpcelpaqlgyvrayddtvsedqilpyvpgldvvnekmne
    gyknfklnkpdiaiecfreaiyritllmvddaedeklahkiletareyilglsielerrs
    lkegntvrmlelaayftkaklspihrtnalqvamsqhfkhknflqasyfageflkiissg
    praeqarkiknkadsmasdaipidfdpyakfdicaatykpiyedtpsvsdpltgskyvit
    ekdkidriamiskigapasglrirv
    

    Sequence, based on observed residues (ATOM records):
    >3mv3A (A:)
    metaiwiknsklpavlvaagafdaavqalskqvgvvkleplkkyftniyegcrtyipstp
    celpaqlgyvrayddtvsedqilpyvpgldvvnekmnegyknfklnkpdiaiecfreaiy
    ritllmvddaedeklahkiletareyilglsielerrslkegntvrmlelaayftkakls
    pihrtnalqvamsqhfkhknflqasyfageflkiissgpraeqarkiknkadsmasdaip
    idfdpyakfdicaatykpiyedtpsvsdpltgskyvitekdkidriamiskigapasglr
    irv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mv3B (B:)
    mgsshhhhhhsqdpmdyfnikqnyytgnfvqclqeiekfskvtdntllfykaktllalgq
    yqsqdptsklgkvldlyvqfldtknieelenllkdkqnspyelyllataqailgdldksl
    etcvegidndeaegttellllaievallnnnvstastifdnytnaiedtvsgdnemilnl
    aesyikfatnketatsnfyyyeelsqtfptwktqlgllnlhlqqrniaeaqgivelllsd
    yysveqkenavlykptflanqitlalmqgldtedltnqlvkldhehafikhhqeidakfd
    elvrkydtsn
    

    Sequence, based on observed residues (ATOM records):
    >3mv3B (B:)
    mdyfnikqnyytgnfvqclqeiekfskvtdntllfykaktllalgqyqsqdptsklgkvl
    dlyvqfldtknieelenllkdkqnspyelyllataqailgdldksletcvegidndeaeg
    ttellllaievallnnnvstastifdnytnaiedtvsgdnemilnlaesyikfatnketa
    tsnfyyyeelsqtfptwktqlgllnlhlqqrniaeaqgivelllsdyysveqkenavlyk
    ptflanqitlalmqgldtedltnqlvkldhehafikhhqeidakfdelvrkyd
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mv3C (C:)
    mgsshhhhhhssglevlfqgphmetaiwiknsklpavlvaagafdaavqalskqvgvvkl
    eplkkyftniyegcrtyipstpcelpaqlgyvrayddtvsedqilpyvpgldvvnekmne
    gyknfklnkpdiaiecfreaiyritllmvddaedeklahkiletareyilglsielerrs
    lkegntvrmlelaayftkaklspihrtnalqvamsqhfkhknflqasyfageflkiissg
    praeqarkiknkadsmasdaipidfdpyakfdicaatykpiyedtpsvsdpltgskyvit
    ekdkidriamiskigapasglrirv
    

    Sequence, based on observed residues (ATOM records):
    >3mv3C (C:)
    metaiwiknsklpavlvaagafdaavqalskqvgvvkleplkkyftniyegcrtyipstp
    celpaqlgyvrayddtvsedqilpyvpgldvvnekmnegyknfklnkpdiaiecfreaiy
    ritllmvddaedeklahkiletareyilglsielerrslkegntvrmlelaayftkakls
    pihrtnalqvamsqhfkhknflqasyfageflkiissgpraeqarkiknkadsmasdaip
    idfdpyakfdicaatykpiyedtpsvsdpltgskyvitekdkidriamiskigapasglr
    irv
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mv3D (D:)
    mgsshhhhhhsqdpmdyfnikqnyytgnfvqclqeiekfskvtdntllfykaktllalgq
    yqsqdptsklgkvldlyvqfldtknieelenllkdkqnspyelyllataqailgdldksl
    etcvegidndeaegttellllaievallnnnvstastifdnytnaiedtvsgdnemilnl
    aesyikfatnketatsnfyyyeelsqtfptwktqlgllnlhlqqrniaeaqgivelllsd
    yysveqkenavlykptflanqitlalmqgldtedltnqlvkldhehafikhhqeidakfd
    elvrkydtsn
    

    Sequence, based on observed residues (ATOM records):
    >3mv3D (D:)
    mdyfnikqnyytgnfvqclqeiekfskvtdntllfykaktllalgqyqsqdptsklgkvl
    dlyvqfldtknieelenllkdkqnspyelyllataqailgdldksletcvegidndeaeg
    ttellllaievallnnnvstastifdnytnaiedtvsgdnemilnlaesyikfatnketa
    tsnfyyyeelsqtfptwktqlgllnlhlqqrniaeaqgivelllsdyysveqkenavlyk
    ptflanqitlalmqgldtedltnqlvkldhehafikhhqeidakfdelvrkyd
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mv3E (E:)
    mgsshhhhhhssglevlfqgphmetaiwiknsklpavlvaagafdaavqalskqvgvvkl
    eplkkyftniyegcrtyipstpcelpaqlgyvrayddtvsedqilpyvpgldvvnekmne
    gyknfklnkpdiaiecfreaiyritllmvddaedeklahkiletareyilglsielerrs
    lkegntvrmlelaayftkaklspihrtnalqvamsqhfkhknflqasyfageflkiissg
    praeqarkiknkadsmasdaipidfdpyakfdicaatykpiyedtpsvsdpltgskyvit
    ekdkidriamiskigapasglrirv
    

    Sequence, based on observed residues (ATOM records):
    >3mv3E (E:)
    metaiwiknsklpavlvaagafdaavqalskqvgvvkleplkkyftniyegcrtyipstp
    celpaqlgyvrayddtvsedqilpyvpgldvvnekmnegyknfklnkpdiaiecfreaiy
    ritllmvddaedeklahkiletareyilglsielerrslkegntvrmlelaayftkakls
    pihrtnalqvamsqhfkhknflqasyfageflkiissgpraeqarkiknkadsmasdaip
    idfdpyakfdicaatykpiyedtpsvsdpltgskyvitekdkidriamiskigapasglr
    irv
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mv3F (F:)
    mgsshhhhhhsqdpmdyfnikqnyytgnfvqclqeiekfskvtdntllfykaktllalgq
    yqsqdptsklgkvldlyvqfldtknieelenllkdkqnspyelyllataqailgdldksl
    etcvegidndeaegttellllaievallnnnvstastifdnytnaiedtvsgdnemilnl
    aesyikfatnketatsnfyyyeelsqtfptwktqlgllnlhlqqrniaeaqgivelllsd
    yysveqkenavlykptflanqitlalmqgldtedltnqlvkldhehafikhhqeidakfd
    elvrkydtsn
    

    Sequence, based on observed residues (ATOM records):
    >3mv3F (F:)
    mdyfnikqnyytgnfvqclqeiekfskvtdntllfykaktllalgqyqsqdptsklgkvl
    dlyvqfldtknieelenllkdkqnspyelyllataqailgdldksletcvegidndeaeg
    ttellllaievallnnnvstastifdnytnaiedtvsgdnemilnlaesyikfatnketa
    tsnfyyyeelsqtfptwktqlgllnlhlqqrniaeaqgivelllsdyysveqkenavlyk
    ptflanqitlalmqgldtedltnqlvkldhehafikhhqeidakfdelvrkyd