PDB entry 3muw

View 3muw on RCSB PDB site
Description: pseudo-atomic structure of the e2-e1 protein shell in sindbis virus
Deposited on 2010-05-03, released 2010-11-24
The last revision was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: EM
Resolution: 9 Å
R-factor: N/A
AEROSPACI score: -0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3muwA (A:)
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahadytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaeckppa
    

    Sequence, based on observed residues (ATOM records):
    >3muwA (A:)
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahadytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaec
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3muwD (D:)
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahadytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaeckppa
    

    Sequence, based on observed residues (ATOM records):
    >3muwD (D:)
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahadytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaec
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3muwE (E:)
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahadytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaeckppa
    

    Sequence, based on observed residues (ATOM records):
    >3muwE (E:)
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahadytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaec
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3muwF (F:)
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahadytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaeckppa
    

    Sequence, based on observed residues (ATOM records):
    >3muwF (F:)
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahadytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaec
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >3muwU (U:)
    sviddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaas
    ankyrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssns
    atsctlarkikpkfvgrekydlppvhgkkipctvydrlkettagyitmhrprphaytsyl
    eessgkvyakppsgknityeckcgdyktgtvstrteitgctaikqcvayksdqtkwvfns
    pdlirhddhtaqgklhlpfklipstcmvpvahapnvihgfkhislqldtdhltllttrrl
    ganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqesa
    

    Sequence, based on observed residues (ATOM records):
    >3muwU (U:)
    ftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaasankyr
    ymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssnsatsct
    larkikpkfvgrekydlppvhgkkipctvydlhlpfklipstcmvpvahapnvihgfkhi
    slqldtdhltllttrrlganpepttewivgktvrnftvdrdgleyiwgnhepvrvya
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3muwX (X:)
    sviddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaas
    ankyrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssns
    atsctlarkikpkfvgrekydlppvhgkkipctvydrlkettagyitmhrprphaytsyl
    eessgkvyakppsgknityeckcgdyktgtvstrteitgctaikqcvayksdqtkwvfns
    pdlirhddhtaqgklhlpfklipstcmvpvahapnvihgfkhislqldtdhltllttrrl
    ganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqesa
    

    Sequence, based on observed residues (ATOM records):
    >3muwX (X:)
    ftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaasankyr
    ymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssnsatsct
    larkikpkfvgrekydlppvhgkkipctvydlhlpfklipstcmvpvahapnvihgfkhi
    slqldtdhltllttrrlganpepttewivgktvrnftvdrdgleyiwgnhepvrvya
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >3muwY (Y:)
    sviddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaas
    ankyrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssns
    atsctlarkikpkfvgrekydlppvhgkkipctvydrlkettagyitmhrprphaytsyl
    eessgkvyakppsgknityeckcgdyktgtvstrteitgctaikqcvayksdqtkwvfns
    pdlirhddhtaqgklhlpfklipstcmvpvahapnvihgfkhislqldtdhltllttrrl
    ganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqesa
    

    Sequence, based on observed residues (ATOM records):
    >3muwY (Y:)
    ftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaasankyr
    ymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssnsatsct
    larkikpkfvgrekydlppvhgkkipctvydlhlpfklipstcmvpvahapnvihgfkhi
    slqldtdhltllttrrlganpepttewivgktvrnftvdrdgleyiwgnhepvrvya
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >3muwZ (Z:)
    sviddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaas
    ankyrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssns
    atsctlarkikpkfvgrekydlppvhgkkipctvydrlkettagyitmhrprphaytsyl
    eessgkvyakppsgknityeckcgdyktgtvstrteitgctaikqcvayksdqtkwvfns
    pdlirhddhtaqgklhlpfklipstcmvpvahapnvihgfkhislqldtdhltllttrrl
    ganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqesa
    

    Sequence, based on observed residues (ATOM records):
    >3muwZ (Z:)
    ftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaasankyr
    ymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssnsatsct
    larkikpkfvgrekydlppvhgkkipctvydlhlpfklipstcmvpvahapnvihgfkhi
    slqldtdhltllttrrlganpepttewivgktvrnftvdrdgleyiwgnhepvrvya