PDB entry 3muu

View 3muu on RCSB PDB site
Description: crystal structure of the sindbis virus e2-e1 heterodimer at low ph
Deposited on 2010-05-03, released 2010-11-24
The last revision was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 3.29 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03316
      • linker (358-359)
    • Uniprot P03316 (360-739)
      • engineered mutation (434)
  • Chain 'B':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03316
      • linker (358-359)
    • Uniprot P03316 (360-739)
      • engineered mutation (434)
  • Chain 'C':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03316
      • linker (359)
    • Uniprot P03316 (360-739)
      • engineered mutation (434)
  • Chain 'D':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03316
      • linker (358-359)
    • Uniprot P03316 (360-739)
      • engineered mutation (434)
  • Chain 'E':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03316
      • linker (357-359)
    • Uniprot P03316 (360-739)
      • engineered mutation (434)
  • Chain 'F':
    Compound: Structural polyprotein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03316
      • linker (359)
    • Uniprot P03316 (360-739)
      • engineered mutation (434)
  • Heterogens: NAG, BMA, MAN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3muuA (A:)
    sviddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaas
    ankyrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssns
    atsctlarkikpkfvgrekydlppvhgkkipctvydrlkettagyitmhrprphaytsyl
    eessgkvyakppsgknityeckcgdyktgtvstrteitgctaikqcvayksdqtkwvfns
    pdlirhddhtaqgklhlpfklipstcmvpvahapnvihgfkhislqldtdhltllttrrl
    ganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqesagggswshpqfekgggg
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaeckppahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3muuA (A:)
    ftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaasankyr
    ymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssnsatsct
    larkikpkfvgrekydlppvhgkkipctvydrlhlpfklipstcmvpvahapnvihgfkh
    islqldtdhltllttrrlganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqe
    sggyehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvps
    pkikccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasd
    haqaikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkv
    vihrglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqas
    sgfemwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvs
    tvkcevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfs
    taspqanfivslcgkkttcnaec
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3muuB (B:)
    sviddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaas
    ankyrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssns
    atsctlarkikpkfvgrekydlppvhgkkipctvydrlkettagyitmhrprphaytsyl
    eessgkvyakppsgknityeckcgdyktgtvstrteitgctaikqcvayksdqtkwvfns
    pdlirhddhtaqgklhlpfklipstcmvpvahapnvihgfkhislqldtdhltllttrrl
    ganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqesagggswshpqfekgggg
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaeckppahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3muuB (B:)
    ftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaasankyr
    ymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssnsatsct
    larkikpkfvgrekydlppvhgkkipctvydrklhlpfklipstcmvpvahapnvihgfk
    hislqldtdhltllttrrlganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaq
    ggyehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpsp
    kikccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdh
    aqaikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvv
    ihrglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqass
    gfemwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvst
    vkcevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfst
    aspqanfivslcgkkttcnaec
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3muuC (C:)
    sviddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaas
    ankyrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssns
    atsctlarkikpkfvgrekydlppvhgkkipctvydrlkettagyitmhrprphaytsyl
    eessgkvyakppsgknityeckcgdyktgtvstrteitgctaikqcvayksdqtkwvfns
    pdlirhddhtaqgklhlpfklipstcmvpvahapnvihgfkhislqldtdhltllttrrl
    ganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqesagggswshpqfekgggg
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaeckppahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3muuC (C:)
    dftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaasanky
    rymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssnsatsc
    tlarkikpkfvgrekydlppvhgkkipctvydrllhlpfklipstcmvpvahapnvihgf
    khislqldtdhltllttrrlganpepttewivgktvrnftvdrdgleyiwgnhepvrvya
    qgyehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpsp
    kikccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdh
    aqaikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvv
    ihrglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqass
    gfemwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvst
    vkcevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfst
    aspqanfivslcgkkttcnaec
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3muuD (D:)
    sviddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaas
    ankyrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssns
    atsctlarkikpkfvgrekydlppvhgkkipctvydrlkettagyitmhrprphaytsyl
    eessgkvyakppsgknityeckcgdyktgtvstrteitgctaikqcvayksdqtkwvfns
    pdlirhddhtaqgklhlpfklipstcmvpvahapnvihgfkhislqldtdhltllttrrl
    ganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqesagggswshpqfekgggg
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaeckppahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3muuD (D:)
    ddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaasank
    yrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssnsats
    ctlarkikpkfvgrekydlppvhgkkipctvydrhlpfklipstcmvpvahapnvihgfk
    hislqldtdhltllttrrlganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaq
    ggyehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpsp
    kikccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdh
    aqaikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvv
    ihrglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqass
    gfemwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvst
    vkcevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfst
    aspqanfivslcgkkttcnaec
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3muuE (E:)
    sviddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaas
    ankyrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssns
    atsctlarkikpkfvgrekydlppvhgkkipctvydrlkettagyitmhrprphaytsyl
    eessgkvyakppsgknityeckcgdyktgtvstrteitgctaikqcvayksdqtkwvfns
    pdlirhddhtaqgklhlpfklipstcmvpvahapnvihgfkhislqldtdhltllttrrl
    ganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqesagggswshpqfekgggg
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaeckppahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3muuE (E:)
    ftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaasankyr
    ymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssnsatsct
    larkikpkfvgrekydlppvhgkkipctvydrllhlpfklipstcmvpvahapnvihgfk
    hislqldtdhltllttrrlganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaq
    gggyehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvps
    pkikccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasd
    haqaikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkv
    vihrglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqas
    sgfemwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvs
    tvkcevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfs
    taspqanfivslcgkkttcnaec
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3muuF (F:)
    sviddftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaas
    ankyrymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssns
    atsctlarkikpkfvgrekydlppvhgkkipctvydrlkettagyitmhrprphaytsyl
    eessgkvyakppsgknityeckcgdyktgtvstrteitgctaikqcvayksdqtkwvfns
    pdlirhddhtaqgklhlpfklipstcmvpvahapnvihgfkhislqldtdhltllttrrl
    ganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqesagggswshpqfekgggg
    yehattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspki
    kccgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaq
    aikvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvih
    rglvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgf
    emwknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvk
    cevsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstas
    pqanfivslcgkkttcnaeckppahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3muuF (F:)
    ftltspylgtcsychhtvpcfspvkieqvwdeaddntiriqtsaqfgydqsgaasankyr
    ymslkqdhtvkegtmddikistsgpcrrlsykgyfllakcppgdsvtvsivssnsatsct
    larkikpkfvgrekydlppvhgkkipctvydrlpfklipstcmvpvahapnvihgfkhis
    lqldtdhltllttrrlganpepttewivgktvrnftvdrdgleyiwgnhepvrvyaqgye
    hattvpnvpqipykalveragyaplnleitvmssevlpstnqeyitckfttvvpspkikc
    cgslecqpaahagytckvfggvypfmwggaqcfcdsensqmseayvelsadcasdhaqai
    kvhtaamkvglrivygnttsfldvyvngvtpgtskdlkviagpisasftpfdhkvvihrg
    lvynydfpeygamkpgafgdiqatsltskdliastdirllkpsaknvhvpytqassgfem
    wknnsgrplqetapfgckiavnplravdcsygnipisidipnaafirtsdaplvstvkce
    vsectysadfggmatlqyvsdregqcpvhshsstatlqestvhvlekgavtvhfstaspq
    anfivslcgkkttcnaec