PDB entry 3mus

View 3mus on RCSB PDB site
Description: 2A Resolution Structure of Rat Type B Cytochrome b5
Class: electron transport
Keywords: CYTOCHROME b5, HEME, ELECTRON TRANSPORT
Deposited on 2010-05-03, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b5 type B
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3musa_
  • Chain 'B':
    Compound: Cytochrome b5 type B
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04166 (0-85)
      • expression tag (86)
    Domains in SCOPe 2.07: d3musb1, d3musb2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3musA (A:)
    dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeevlleqagadatesfed
    vghspdaremlkqyyigdvhpndlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3musA (A:)
    pavtyyrleevakrntaeetwmvihgrvyditrflsehpggeevlleqagadatesfedv
    ghspdaremlkqyyigdvhpndlkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3musB (B:)
    dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeevlleqagadatesfed
    vghspdaremlkqyyigdvhpndlkpa