PDB entry 3mur

View 3mur on RCSB PDB site
Description: Crystal Structure of the C92U mutant c-di-GMP riboswith bound to c-di-GMP
Deposited on 2010-05-03, released 2010-08-25
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.203
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
  • Chain 'R':
    Compound: C92U mutant c-di-GMP riboswitch
    Species: synthetic, synthetic
  • Heterogens: C2E, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3murP (P:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records):
    >3murP (P:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'R':
    No sequence available.