PDB entry 3muq

View 3muq on RCSB PDB site
Description: The crystal structure of a conserved functionally unknown protein from Vibrio parahaemolyticus RIMD 2210633
Deposited on 2010-05-03, released 2010-05-12
The last revision was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.166
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized conserved protein
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VP1501
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: uncharacterized conserved protein
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VP1501
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3muqA (A:)
    snaaehvrlatttstyhsglldyllpqfekdtgykvdviaagtgkalkmgengdvdlvmt
    hapkaegtfvekgygvlprklmyndfvivgpkadpakikddesvldvfkeianknatfis
    rgddsgthkkemgfwaqtkiepnfggyrsvgqgmgptlnmasemqgytmsdrgtwlayqn
    kldleilfqgdeklfnpyqvilvnperyptinyqgakafsdwlvnprgqelingfrl
    

    Sequence, based on observed residues (ATOM records):
    >3muqA (A:)
    ehvrlatttstyhsglldyllpqfekdtgykvdviaagtgkalkmgengdvdlvmthapk
    aegtfvekgygvlprklmyndfvivgpkadpakikddesvldvfkeianknatfisrgdd
    sgthkkemgfwaqtkiepnfggyrsvgqgmgptlnmasemqgytmsdrgtwlayqnkldl
    eilfqgdeklfnpyqvilvnperyptinyqgakafsdwlvnprgqelingfrl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3muqB (B:)
    snaaehvrlatttstyhsglldyllpqfekdtgykvdviaagtgkalkmgengdvdlvmt
    hapkaegtfvekgygvlprklmyndfvivgpkadpakikddesvldvfkeianknatfis
    rgddsgthkkemgfwaqtkiepnfggyrsvgqgmgptlnmasemqgytmsdrgtwlayqn
    kldleilfqgdeklfnpyqvilvnperyptinyqgakafsdwlvnprgqelingfrl
    

    Sequence, based on observed residues (ATOM records):
    >3muqB (B:)
    ehvrlatttstyhsglldyllpqfekdtgykvdviaagtgkalkmgengdvdlvmthapk
    aegtfvekgygvlprklmyndfvivgpkadpakikddesvldvfkeianknatfisrgdd
    sgthkkemgfwaqtkiepnfggyrsvgqgmgptlnmasemqgytmsdrgtwlayqnkldl
    eilfqgdeklfnpyqvilvnperyptinyqgakafsdwlvnprgqelingfrl