PDB entry 3mup

View 3mup on RCSB PDB site
Description: cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac037
Class: apoptosis inhibitor
Keywords: Zinc-Finger motif, APOPTOSIS INHIBITOR
Deposited on 2010-05-03, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.229
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mupa_
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mupb_
  • Chain 'C':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mupc1, d3mupc2
  • Chain 'D':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mupd_
  • Heterogens: SMK, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mupA (A:)
    mensletlrfsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfcc
    dgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgryphlleqllstslehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mupA (A:)
    sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
    ddpwvehakwfprceflirmkgqefvdeiqgryphlleqll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mupB (B:)
    mensletlrfsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfcc
    dgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgryphlleqllstslehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mupB (B:)
    isnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgd
    dpwvehakwfprceflirmkgqefvdeiqgryphlleqll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mupC (C:)
    mensletlrfsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfcc
    dgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgryphlleqllstslehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mupC (C:)
    sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
    ddpwvehakwfprceflirmkgqefvdeiqgryphlleqllst
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mupD (D:)
    mensletlrfsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfcc
    dgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgryphlleqllstslehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mupD (D:)
    sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
    ddpwvehakwfprceflirmkgqefvdeiqgryphlleqlls