PDB entry 3muo

View 3muo on RCSB PDB site
Description: APPEP_PEPCLOSE+PP closed state
Class: Hydrolase/Hydrolase Inhibitor
Keywords: PROLYL ENDOPEPTIDASE, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-05-03, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.16
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: Aeromonas punctata [TaxId:648]
    Gene: prolyl endopeptidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X6R4 (Start-692)
      • engineered mutation (85-86)
      • see remark 999 (108)
      • engineered mutation (244)
      • see remark 999 (327-328)
      • see remark 999 (336-337)
      • see remark 999 (350)
      • engineered mutation (378-380)
      • see remark 999 (579)
    Domains in SCOPe 2.07: d3muoa1, d3muoa2
  • Heterogens: ZPR, SUC, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3muoA (A:)
    gshmsgkarlhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdyla
    qipyraaikeklaaswnyakegapfwwgryhyffkndglqnqnvlwrqqegkpaevfldp
    ntlspdgttaldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgi
    swlgnegffyssydkpdgselsartdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgat
    vtedqrfllisaanstsgnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnr
    dapnrrlvtvdaanpgpahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegk
    rvrevalpglgsvsgfngywwdpalyfgfenyaqpptlyrfepksgaislyrasaapfkp
    edyvseqrfyqskdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwl
    dlggvyavanlrgggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairgg
    snggllvgavmtqrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylk
    gysplhnvrpgvsypstmvttadhddrvvpahsfkfaatlqadnagphpqlirietnagh
    gagtpvaklieqsadiyaftlyemgyrelprqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3muoA (A:)
    lhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdylaqipyraaik
    eklaaswnyakegapfwwgryhyffkndglqnqnvlwrqqegkpaevfldpntlspdgtt
    aldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgiswlgnegff
    yssydkpdgselsartdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgatvtedqrfll
    isaanstsgnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnrdapnrrlvt
    vdaanpgpahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegkrvrevalpg
    lgsvsgfngywwdpalyfgfenyaqpptlyrfepksgaislyrasaapfkpedyvseqrf
    yqskdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwldlggvyava
    nlrgggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairggsnggllvga
    vmtqrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylkgysplhnvr
    pgvsypstmvttadhddrvvpahsfkfaatlqadnagphpqlirietnaghgagtpvakl
    ieqsadiyaftlyemgyrelprqp