PDB entry 3mum

View 3mum on RCSB PDB site
Description: Crystal Structure of the G20A mutant c-di-GMP riboswith bound to c-di-GMP
Class: RNA binding PROTEIN/RNA
Keywords: riboswitch, c-di-GMP, RNA binding PROTEIN-rna complex
Deposited on 2010-05-03, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.211
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.07: d3mump_
  • Chain 'R':
    Compound: G20A mutant c-di-GMP Riboswitch
    Species: synthetic, synthetic
  • Heterogens: C2E, MG, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3mumP (P:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mumP (P:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdi
    

  • Chain 'R':
    No sequence available.