PDB entry 3mul

View 3mul on RCSB PDB site
Description: Crystal structure of Brd4 bromodomain 1 with butyrylated histone H3-K(buty)14
Deposited on 2010-05-03, released 2010-08-11
The last revision was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.18
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Brd4, Mcap
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ESU6 (4-End)
      • expression tag (2-3)
  • Chain 'D':
    Compound: peptide of Histone H3.3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mulA (A:)
    gamgstnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdy
    ykiiktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklf
    lqkinelptee
    

    Sequence, based on observed residues (ATOM records):
    >3mulA (A:)
    mgstnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyyk
    iiktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflq
    kinelpt
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mulD (D:)
    ggxaprkq
    

    Sequence, based on observed residues (ATOM records):
    >3mulD (D:)
    gx