PDB entry 3muh

View 3muh on RCSB PDB site
Description: Crystal structure of PG9 light chain
Class: immune system
Keywords: PG9, HIV, immune system
Deposited on 2010-05-03, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Antibody PG9 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUH
    Domains in SCOPe 2.07: d3muhl1, d3muhl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3muhL (L:)
    qsaltqpasvsgspgqsitiscngtsndvggyesvswyqqhpgkapkvviydvskrpsgv
    snrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3muhL (L:)
    saltqpasvsgspgqsitiscngtsndvggyesvswyqqhpgkapkvviydvskrpsgvs
    nrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshksyscqvthegstvektvapt