PDB entry 3muf

View 3muf on RCSB PDB site
Description: Shikimate kinase from Helicobacter pylori in complex with shikimate-3-phosphate and ADP
Class: Transferase
Keywords: helix-sheet complex, Transferase
Deposited on 2010-05-03, released 2011-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.234
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: Helicobacter pylori [TaxId:210]
    Gene: AroK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mufa_
  • Heterogens: ADP, S3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mufA (A:)
    hhhhhhmqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelged
    nfrmfeknlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkere
    krpllnnltqakelfekrqalyeknasfiidargglnnslkqvlqfia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mufA (A:)
    qhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfek
    nlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerekrpllnn
    ltqakelfekrqalyeknasfiidargglnnslkqvlqfi