PDB entry 3mue

View 3mue on RCSB PDB site
Description: Crystal Structure of Pantoate-beta-Alanine Ligase from Salmonella typhimurium
Class: ligase
Keywords: alpha-beta fold, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, LIGASE
Deposited on 2010-05-03, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.181
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate synthetase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: panC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRR1 (3-286)
      • expression tag (2)
    Domains in SCOPe 2.07: d3muea1, d3muea2
  • Chain 'B':
    Compound: Pantothenate synthetase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: panC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRR1 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3mueb1, d3mueb2
  • Chain 'C':
    Compound: Pantothenate synthetase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: panC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRR1 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3muec1, d3muec2
  • Chain 'D':
    Compound: Pantothenate synthetase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: panC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRR1 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3mued1, d3mued2
  • Heterogens: GOL, EOH, SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mueA (A:)
    snamliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifv
    npmqfdrpddlvryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstm
    legasrpghfrgvstivsklfnliqpdiacfgekdfqqlalirkmvadmsydieivgvpi
    irakdglalssrnayltaeqrkiapglynvmnsiaekliagnrelqeiiaiaeqelnekg
    fraddiqirdadtlleltetskravilaaawlgqarlidnqsvtlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mueA (A:)
    amliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifvnp
    mqfdrpddlvryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstmle
    gasrpghfrgvstivsklfnliqpdiacfgekdfqqlalirkmvadmsydieivgvpiir
    akdglalssrnayltaeqrkiapglynvmnsiaekliagnrelqeiiaiaeqelnekgfr
    addiqirdadtlleltetskravilaaawlgqarlidnqsvtlaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mueB (B:)
    snamliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifv
    npmqfdrpddlvryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstm
    legasrpghfrgvstivsklfnliqpdiacfgekdfqqlalirkmvadmsydieivgvpi
    irakdglalssrnayltaeqrkiapglynvmnsiaekliagnrelqeiiaiaeqelnekg
    fraddiqirdadtlleltetskravilaaawlgqarlidnqsvtlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mueB (B:)
    namliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifvn
    pmqfdrpddlvryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstml
    egasrpghfrgvstivsklfnliqpdiacfgekdfqqlalirkmvadmsydieivgvpii
    rakdglalssrnayltaeqrkiapglynvmnsiaekliagnrelqeiiaiaeqelnekgf
    raddiqirdadtlleltetskravilaaawlgqarlidnqsvtla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mueC (C:)
    snamliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifv
    npmqfdrpddlvryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstm
    legasrpghfrgvstivsklfnliqpdiacfgekdfqqlalirkmvadmsydieivgvpi
    irakdglalssrnayltaeqrkiapglynvmnsiaekliagnrelqeiiaiaeqelnekg
    fraddiqirdadtlleltetskravilaaawlgqarlidnqsvtlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mueC (C:)
    amliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifvnp
    mqfdrpddlvryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstmle
    gasrpghfrgvstivsklfnliqpdiacfgekdfqqlalirkmvadmsydieivgvpiir
    akdglalssrnayltaeqrkiapglynvmnsiaekliagnrelqeiiaiaeqelnekgfr
    addiqirdadtlleltetskravilaaawlgqarlidnqsvtl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mueD (D:)
    snamliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifv
    npmqfdrpddlvryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstm
    legasrpghfrgvstivsklfnliqpdiacfgekdfqqlalirkmvadmsydieivgvpi
    irakdglalssrnayltaeqrkiapglynvmnsiaekliagnrelqeiiaiaeqelnekg
    fraddiqirdadtlleltetskravilaaawlgqarlidnqsvtlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mueD (D:)
    namliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifvn
    pmqfdrpddlvryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstml
    egasrpghfrgvstivsklfnliqpdiacfgekdfqqlalirkmvadmsydieivgvpii
    rakdglalssrnayltaeqrkiapglynvmnsiaekliagnrelqeiiaiaeqelnekgf
    raddiqirdadtlleltetskravilaaawlgqarlidnqsvtl