PDB entry 3mud

View 3mud on RCSB PDB site
Description: structure of the tropomyosin overlap complex from chicken smooth muscle
Deposited on 2010-05-02, released 2010-06-23
The last revision was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair protein XRCC4,Tropomyosin alpha-1 chain
    Species: Gallus gallus [TaxId:9031]
    Gene: TPM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13426 (4-139)
      • expression tag (2-3)
      • engineered mutation (136)
      • conflict (138)
    • Uniprot P04268 (140-174)
  • Chain 'B':
    Compound: DNA repair protein XRCC4,Tropomyosin alpha-1 chain
    Species: Gallus gallus [TaxId:9031]
    Gene: TPM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13426 (4-139)
      • expression tag (2-3)
      • engineered mutation (136)
      • conflict (138)
    • Uniprot P04268 (140-End)
  • Chain 'C':
    Compound: Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09493 (3-31)
      • expression tag (0-2)
    • Uniprot Q15691 (32-End)
  • Chain 'D':
    Compound: Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09493 (3-31)
      • expression tag (0-2)
    • Uniprot Q15691 (32-End)
  • Heterogens: EDO, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mudA (A:)
    ggsgerkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqead
    dmamekgkyvgelrkallsgagpadvytfnfskescyfffeknlkdvsfrlgsfnlekve
    npaevirelicycldttakneksiddleekvahakeenlnmhqmldqtllelnnm
    

    Sequence, based on observed residues (ATOM records):
    >3mudA (A:)
    sgerkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqeaddm
    amekgkyvgelrkallsgagpadvytfnfskescyfffeknlkdvsfrlgsfnlekvenp
    aevirelicycldttakneksiddleekvahakeenlnmhqmldqtllelnnm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mudB (B:)
    ggsgerkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqead
    dmamekgkyvgelrkallsgagpadvytfnfskescyfffeknlkdvsfrlgsfnlekve
    npaevirelicycldttakneksiddleekvahakeenlnmhqmldqtllelnnm
    

    Sequence, based on observed residues (ATOM records):
    >3mudB (B:)
    sgerkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqeaddm
    amekgkyvgelrkallsgagpadvytfnfskescyfffeknlkdvsfrlgsfnlekvenp
    aevirelicycldttakneksiddleekvahakeenlnmhqmldqtllelnn
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mudC (C:)
    gasmdaikkkmqmlkldkenaldraeqaeadkdfyfgklrnielicqenegendpvlqri
    vdilyatdegfvipd
    

    Sequence, based on observed residues (ATOM records):
    >3mudC (C:)
    gasmdaikkkmqmlkldkenaldraeqaeadkdfyfgklrn
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mudD (D:)
    gasmdaikkkmqmlkldkenaldraeqaeadkdfyfgklrnielicqenegendpvlqri
    vdilyatdegfvipd
    

    Sequence, based on observed residues (ATOM records):
    >3mudD (D:)
    gasmdaikkkmqmlkldkenaldraeqaeadkdfyfgklrnielicqe