PDB entry 3muc

View 3muc on RCSB PDB site
Description:
Deposited on 1998-10-27, released 1999-11-04
The last revision prior to the SCOP 1.71 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d3muca1, d3muca2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d3mucb1, d3mucb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mucA (A:)
    alieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattvgglaygyes
    pegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglp
    vsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvv
    tikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtp
    apimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtml
    egsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltld
    eqrlarfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mucA (A:)
    alieridaiivdlptirqqqtlvvlrvrcsdgvegigeattvgglaygyespegikanid
    ahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrv
    rdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgds
    asvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesi
    esvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlas
    ahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mucB (B:)
    alieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattvgglaygyes
    pegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglp
    vsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvv
    tikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtp
    apimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtml
    egsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltld
    eqrlarfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mucB (B:)
    alieridaiivdlptirqqqtlvvlrvrcsdgvegigeattvgglaygyespegikanid
    ahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrv
    rdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgds
    asvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesi
    esvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlas
    ahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar