PDB entry 3muc

View 3muc on RCSB PDB site
Description: muconate cycloisomerase variant i54v
Class: isomerase
Keywords: muconate cycloisomerase, substrate specificity, isomerase
Deposited on 1998-10-27, released 1999-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (muconate cycloisomerase)
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08310 (0-368)
      • conflict (50)
    Domains in SCOPe 2.07: d3muca1, d3muca2
  • Chain 'B':
    Compound: protein (muconate cycloisomerase)
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08310 (0-368)
      • conflict (50)
    Domains in SCOPe 2.07: d3mucb1, d3mucb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mucA (A:)
    alieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattvgglaygyes
    pegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglp
    vsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvv
    tikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtp
    apimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtml
    egsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltld
    eqrlarfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mucA (A:)
    alieridaiivdlptirqqqtlvvlrvrcsdgvegigeattvgglaygyespegikanid
    ahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrv
    rdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgds
    asvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesi
    esvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlas
    ahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mucB (B:)
    alieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattvgglaygyes
    pegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglp
    vsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvv
    tikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtp
    apimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtml
    egsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltld
    eqrlarfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mucB (B:)
    alieridaiivdlptirqqqtlvvlrvrcsdgvegigeattvgglaygyespegikanid
    ahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrv
    rdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgds
    asvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesi
    esvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlas
    ahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar