PDB entry 3mub

View 3mub on RCSB PDB site
Description: The crystal structure of alanine racemase from Streptococcus pneumoniae
Deposited on 2010-05-02, released 2011-05-11
The last revision was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alanine racemase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: alaR, alr, SP_1698
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: alanine racemase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: alaR, alr, SP_1698
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BEZ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mubA (A:)
    mkasphrptkalihlgairqniqqmgahipqgtlklavvkanayghgavavakaiqddvd
    gfcvsnideaielrqaglskpililgvseieavalakeydftltvaglewiqalldkevd
    ltgltvhlkidsgmgrigfreaseveqaqdllqqhgvcvegifthfatadeesddyfnaq
    lerfktilasmkevpelvhasnsattlwhvetifnavrmgdamyglnpsgavldlpydli
    paltlesalvhvktvpagacmgygatyqadseqviatvpigyadgwtrdmqnfsvlvdgq
    acpivgrvsmdqitirlpklyplgtkvtligsngdkeitatqvatyrvtinyevvcllsd
    ripreyy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mubB (B:)
    mkasphrptkalihlgairqniqqmgahipqgtlklavvkanayghgavavakaiqddvd
    gfcvsnideaielrqaglskpililgvseieavalakeydftltvaglewiqalldkevd
    ltgltvhlkidsgmgrigfreaseveqaqdllqqhgvcvegifthfatadeesddyfnaq
    lerfktilasmkevpelvhasnsattlwhvetifnavrmgdamyglnpsgavldlpydli
    paltlesalvhvktvpagacmgygatyqadseqviatvpigyadgwtrdmqnfsvlvdgq
    acpivgrvsmdqitirlpklyplgtkvtligsngdkeitatqvatyrvtinyevvcllsd
    ripreyy