PDB entry 3mua

View 3mua on RCSB PDB site
Description: Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus.
Class: hydrolase
Keywords: Intracellular xylanase, xylotriose, HYDROLASE
Deposited on 2010-05-02, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: XYNA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3YBZ9 (Start-330)
      • conflict (215)
    Domains in SCOPe 2.07: d3muaa_
  • Chain 'B':
    Compound: xylanase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: XYNA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3YBZ9 (Start-330)
      • conflict (215)
    Domains in SCOPe 2.07: d3muab_
  • Heterogens: XYP, NA, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3muaA (A:)
    mnsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkft
    fqeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvr
    rykgkiycwdvineavadegdellrpskwrqiigddfmeqaflyayeadpdallfyndyn
    ecfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhit
    eldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwl
    dnfpvhgrknwpllfdeqhkpkpafwravsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3muaA (A:)
    nsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftf
    qeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrr
    ykgkiycwdvineavadegdellrpskwrqiigddfmeqaflyayeadpdallfyndyne
    cfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhite
    ldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwld
    nfpvhgrknwpllfdeqhkpkpafwravsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3muaB (B:)
    mnsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkft
    fqeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvr
    rykgkiycwdvineavadegdellrpskwrqiigddfmeqaflyayeadpdallfyndyn
    ecfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhit
    eldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwl
    dnfpvhgrknwpllfdeqhkpkpafwravsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3muaB (B:)
    slpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftfqe
    adrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrryk
    gkiycwdvineavadegdellrpskwrqiigddfmeqaflyayeadpdallfyndynecf
    pekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhiteld
    vsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwldnf
    pvhgrknwpllfdeqhkpkpafwravsv