PDB entry 3mu7

View 3mu7 on RCSB PDB site
Description: Crystal structure of the xylanase and alpha-amylase inhibitor protein (XAIP-II) from scadoxus multiflorus at 1.2 A resolution
Class: hydrolase inhibitor
Keywords: TIM barell, Amylase/xylanase inhibitory protein, HYDROLASE INHIBITOR
Deposited on 2010-05-02, released 2010-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.153
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase and alpha-amylase inhibitor protein
    Species: Scadoxus multiflorus [TaxId:82246]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MU7 (0-272)
    Domains in SCOPe 2.07: d3mu7a_
  • Heterogens: PO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mu7A (A:)
    gsldiavywgqsfdersleatcdsgnyayviigflntfgggqtpaldisghspkglepqi
    khcqsknvkvllsiggpagpysldsrndandlavylhknfllppagtsesrpfgnavldg
    idfhiehggpsqyqllanilssfrlsgsefaltaapqcvypdpnlgtvinsatfdaiwvq
    fynnpqcsysasnasalmnawkewsmkartdkvflgfpahpdaagsgympptkvkfsvfp
    naqdstkfggimlwdsywdtvsqfsnkilgkgv