PDB entry 3mu6

View 3mu6 on RCSB PDB site
Description: Inhibiting the Binding of Class IIa Histone Deacetylases to Myocyte Enhancer Factor-2 by Small Molecules
Class: DNA binding protein/DNA
Keywords: MADS-box/MEF2 domain, transcription co-factors, protein-DNA complex, protein-protein docking, DNA BINDING PROTEIN-DNA complex
Deposited on 2010-05-01, released 2011-11-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.231
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: myocyte-specific enhancer factor 2a
  Species: Homo sapiens [TaxId:9606]
  Gene: MEF2A, MEF2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02078 (0-70)
    • engineered mutation (69)
  Domains in SCOPe 2.05: d3mu6a_
• Chain 'B':
  Compound: myocyte-specific enhancer factor 2a
  Species: Homo sapiens [TaxId:9606]
  Gene: MEF2A, MEF2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02078 (0-70)
    • engineered mutation (69)
  Domains in SCOPe 2.05: d3mu6b_
• Chain 'C':
  Compound: myocyte-specific enhancer factor 2a
  Species: Homo sapiens [TaxId:9606]
  Gene: MEF2A, MEF2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02078 (0-70)
    • engineered mutation (69)
  Domains in SCOPe 2.05: d3mu6c_
• Chain 'D':
  Compound: myocyte-specific enhancer factor 2a
  Species: Homo sapiens [TaxId:9606]
  Gene: MEF2A, MEF2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02078 (0-70)
    • engineered mutation (69)
  Domains in SCOPe 2.05: d3mu6d_
• Chain 'E':
  Compound: DNA (5'-d(*ap*ap*ap*gp*cp*tp*ap*tp*tp*ap*tp*tp*ap*gp*cp*tp*t)-3')
  
• Chain 'F':
  Compound: DNA (5'-d(*tp*ap*ap*gp*cp*tp*ap*ap*tp*ap*ap*tp*ap*gp*cp*tp*t)-3')
  
• Chain 'G':
  Compound: DNA (5'-d(*ap*ap*ap*gp*cp*tp*ap*tp*tp*ap*tp*tp*ap*gp*cp*tp*t)-3')
  
• Chain 'H':
  Compound: DNA (5'-d(*tp*ap*ap*gp*cp*tp*ap*ap*tp*ap*ap*tp*ap*gp*cp*tp*t)-3')
  
• Heterogens: BXL

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mu6A (A:)
  grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
  mdkvllkytay
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mu6B (B:)
  grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
  mdkvllkytay
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mu6C (C:)
  grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
  mdkvllkytay
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mu6D (D:)
  grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
  mdkvllkytay
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.