PDB entry 3mtx

View 3mtx on RCSB PDB site
Description: Crystal structure of chicken MD-1
Deposited on 2010-05-01, released 2010-06-09
The last revision was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein MD-1
    Species: Gallus gallus [TaxId:9031]
    Gene: LY86, MD-1, MD1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein MD-1
    Species: Gallus gallus [TaxId:9031]
    Gene: LY86, MD-1, MD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90890 (4-End)
      • expression tag (2-3)
  • Heterogens: PGT, PGE, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mtxA (A:)
    adpgewpthtvckeenleiyykscdpqqdfafsidrcsdvtthtfdiraamvlrqsikel
    yakvdliingktvlsysetlcgpglsklifcgkkkgehlyyegpitlgikeipqrdytit
    arltnedratvacadftvknyldysaslvpr
    

    Sequence, based on observed residues (ATOM records):
    >3mtxA (A:)
    ewpthtvckeenleiyykscdpqqdfafsidrcsdvtthtfdiraamvlrqsikelyakv
    dliingktvlsysetlcgpglsklifcgkkkgehlyyegpitlgikeipqrdytitarlt
    nedratvacadftvknyl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mtxB (B:)
    adpgewpthtvckeenleiyykscdpqqdfafsidrcsdvtthtfdiraamvlrqsikel
    yakvdliingktvlsysetlcgpglsklifcgkkkgehlyyegpitlgikeipqrdytit
    arltnedratvacadftvknyldysaslvpr
    

    Sequence, based on observed residues (ATOM records):
    >3mtxB (B:)
    pgewpthtvckeenleiyykscdpqqdfafsidrcsdvtthtfdiraamvlrqsikelya
    kvdliingktvlsysetlcgpglsklifcgkkkgehlyyegpitlgikeipqrdytitar
    ltnedratvacadftvknyl