PDB entry 3mtw

View 3mtw on RCSB PDB site
Description: Crystal structure of L-Lysine, L-Arginine carboxypeptidase Cc2672 from Caulobacter Crescentus CB15 complexed with N-methyl phosphonate derivative of L-Arginine
Deposited on 2010-05-01, released 2010-07-28
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-Arginine carboxypeptidase Cc2672
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2672
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, M3R, SO4, GOL, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mtwA (A:)
    aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpgl
    idmhvhldslaevggynsleysdrfwsvvqtanakktleagfttvrnvgaadyddvglre
    aidagyvpgprivtaaisfgatgghcdstffppsmdqknpfnsdspdearkavrtlkkyg
    aqvikicatggvfsrgnepgqqqltyeemkavvdeahmagikvaahahgasgireavrag
    vdtiehaslvddegiklavqkgayfsmdiyntdytqaegkkngvlednlrkdrdigelqr
    enfrkalkagvkmvygtdagiyphgdnakqfavmvrygatplqaiqsatltaaealgrsk
    dvgqvavgrygdmiavagdpladvttlekpvfvmkggavvkap