PDB entry 3mtv

View 3mtv on RCSB PDB site
Description: The Crystal Structure of the PRRSV Nonstructural Protein Nsp1
Deposited on 2010-04-30, released 2010-05-19
The last revision was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.203
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Papain-like Cysteine Protease
    Species: Porcine reproductive and respiratory syndrome virus [TaxId:28344]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mtvA (A:)
    advydigrgavmyvaggkvswaprggnevkfepvpkelklvanrlhtsfpphhvvdmskf
    tfitpgsgvsmrveyqygclpadtvpegncwwrlldslppevqykeirhanqfgyqtkhg
    vpgkylqrrlqvnglravtdthgpiviqyfsvkeswirhlklveepslpgfedllrirve
    pntsplagkdekifrfgshkwyg