PDB entry 3mtt

View 3mtt on RCSB PDB site
Description: Crystal structure of iSH2 domain of human p85beta, Northeast Structural Genomics Consortium Target HR5531C
Deposited on 2010-04-30, released 2010-05-19
The last revision was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.25
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3R2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mttA (A:)
    mivkedsveavgaqlkvyhqqyqdksreydqlyeeytrtsqelqmkrtaieafnetikif
    eeqgqtqekcskeylerfrregnekemqrillnserlksriaeihesrtkleqqlraqas
    dnreidkrmnslkpdlmqlrkirdqylvwltqkgarqkkinewlgiknetedqyalmedl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mttA (A:)
    edsveavgaqlkvyhqqyqdksreydqlyeeytrtsqelqmkrtaieafnetikifeeqg
    qtqekcskeylerfrregnekemqrillnserlksriaeihesrtkleqqlraqasdnre
    idkrmnslkpdlmqlrkirdqylvwltqkgarqkkinewlgik