PDB entry 3mtr

View 3mtr on RCSB PDB site
Description: Crystal structure of the Ig5-FN1 tandem of human NCAM
Deposited on 2010-04-30, released 2010-06-23
The last revision was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neural cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCAM1, NCAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13591 (17-End)
      • expression tag (14-16)
  • Chain 'B':
    Compound: Neural cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCAM1, NCAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13591 (17-End)
      • expression tag (16)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mtrA (A:)
    atyaaassalvprgshmyapklqgpvavytwegnqvnitcevfaypsatiswfrdgqllp
    ssnysnikiyntpsasylevtpdsendfgnynctavnrigqeslefilvqadtpsspsid
    qvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasmegivtivgl
    kpettyavrlaalngkglgeisaasefktqpvqge
    

    Sequence, based on observed residues (ATOM records):
    >3mtrA (A:)
    shmyapklqgpvavytwegnqvnitcevfaypsatiswfrdgqllpssnysnikiyntps
    asylevtpdsendfgnynctavnrigqeslefilvqadtpsspsidqvepysstaqvqfd
    epeatggvpilkykaewravgeevwhskwydakeasmegivtivglkpettyavrlaaln
    gkglgeisaasefktqp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mtrB (B:)
    atyaaassalvprgshmyapklqgpvavytwegnqvnitcevfaypsatiswfrdgqllp
    ssnysnikiyntpsasylevtpdsendfgnynctavnrigqeslefilvqadtpsspsid
    qvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasmegivtivgl
    kpettyavrlaalngkglgeisaasefktqpvqge
    

    Sequence, based on observed residues (ATOM records):
    >3mtrB (B:)
    myapklqgpvavytwegnqvnitcevfaypsatiswfrdgqllpssnysnikiyntpsas
    ylevtpdsendfgnynctavnrigqeslefilvqadtpsspsidqvepysstaqvqfdep
    eatggvpilkykaewravgeevwhskwydakeasmegivtivglkpettyavrlaalngk
    glgeisaasefktqpvq