PDB entry 3mtq

View 3mtq on RCSB PDB site
Description: Crystal structure of a putative phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) permease (KPN_04802) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.70 A resolution
Class: transferase
Keywords: PTS system fructose IIA component, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, TRANSFERASE
Deposited on 2010-04-30, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) permease
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: KPN78578_47240, KPN_04802
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6THW4 (19-End)
      • leader sequence (13-18)
    Domains in SCOPe 2.07: d3mtqa1, d3mtqa2
  • Chain 'B':
    Compound: putative phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) permease
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: KPN78578_47240, KPN_04802
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6THW4 (19-End)
      • leader sequence (13-18)
    Domains in SCOPe 2.07: d3mtqb1, d3mtqb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mtqA (A:)
    mgsdkihhhhhhenlyfqgmkrhyifashgsfangllnsvelilgkqpdihtlcayveee
    vdltqqvealvarfpaqdelivitdifagsvnnefvrflsrphfhllsglnlpliidlli
    saaednteklitealtnakesiqycnqtiasamtmdkdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mtqA (A:)
    nlyfqgmkrhyifashgsfangllnsvelilgkqpdihtlcayveeevdltqqvealvar
    fpaqdelivitdifagsvnnefvrflsrphfhllsglnlpliidllisaaednteklite
    altnakesiqycnqtiasam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mtqB (B:)
    mgsdkihhhhhhenlyfqgmkrhyifashgsfangllnsvelilgkqpdihtlcayveee
    vdltqqvealvarfpaqdelivitdifagsvnnefvrflsrphfhllsglnlpliidlli
    saaednteklitealtnakesiqycnqtiasamtmdkdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mtqB (B:)
    nlyfqgmkrhyifashgsfangllnsvelilgkqpdihtlcayveeevdltqqvealvar
    fpaqdelivitdifagsvnnefvrflsrphfhllsglnlpliidllisaaednteklite
    altnakesiqycnqtia