PDB entry 3mtn

View 3mtn on RCSB PDB site
Description: Usp21 in complex with a ubiquitin-based, USP21-specific inhibitor
Class: hydrolase
Keywords: ubiquitin-specific protease activity, hydrolase, ubiquitin biology, structural genomics consortium, sgc, activator, chromatin regulator, nucleus, protease, thiol protease, transcription, transcription regulation, ubl conjugation pathway, isopeptide bond, phosphoprotein, inhibitor
Deposited on 2010-04-30, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 21
    Species: Homo sapiens [TaxId:9606]
    Gene: PP1490, USP21, USP23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mtna_
  • Chain 'B':
    Compound: ubiquitin variant ubv.21.4
    Species: Homo sapiens [TaxId:9606]
    Gene: RPS27A, UBA52, UBA80, UBB, UBC, UBCEP1, UBCEP2, UBQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (3-78)
      • expression tag (2)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d3mtnb1, d3mtnb2
  • Chain 'C':
    Compound: Ubiquitin carboxyl-terminal hydrolase 21
    Species: Homo sapiens [TaxId:9606]
    Gene: PP1490, USP21, USP23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mtnc_
  • Chain 'D':
    Compound: ubiquitin variant ubv.21.4
    Species: Homo sapiens [TaxId:9606]
    Gene: RPS27A, UBA52, UBA80, UBB, UBC, UBCEP1, UBCEP2, UBQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (3-78)
      • expression tag (2)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d3mtnd1, d3mtnd2
  • Heterogens: ZN, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mtnA (A:)
    mgsshhhhhhssglvprgssghvglrnlgntcflnavlqclsstrplrdfclrrdfrqev
    pgggraqelteafadvigalwhpdsceavnptrfravfqkyvpsfsgysqqdaqeflkll
    merlhleinrrgrrappilangpvpspprrggalleepelsdddranlmwkryleredsk
    ivdlfvgqlksclkcqacgyrsttfevfcdlslpipkkgfaggkvslrdcfnlftkeeel
    esenapvcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsikkssvgvdfplqrlsl
    gdfasdkagspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsenqvasse
    gyvlfyqlmqepp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mtnA (A:)
    ghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggraqelteafadvigal
    whpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrlsdddranl
    mwkryleredskivdlfvgqlksclkcqacgyrsttfevfcdlslpipkkgfaggkvslr
    dcfnlftkeeelesenapvcdrcrqktrstkkltvqrfprilvlhlnrfsargsikkssv
    gvdfplqrlslgdfasspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvse
    nqvassegyvlfyqlm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mtnB (B:)
    gshmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls
    dyniqkwstlflllrlrggggggsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mtnB (B:)
    hmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkwstlflllrlrgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mtnC (C:)
    mgsshhhhhhssglvprgssghvglrnlgntcflnavlqclsstrplrdfclrrdfrqev
    pgggraqelteafadvigalwhpdsceavnptrfravfqkyvpsfsgysqqdaqeflkll
    merlhleinrrgrrappilangpvpspprrggalleepelsdddranlmwkryleredsk
    ivdlfvgqlksclkcqacgyrsttfevfcdlslpipkkgfaggkvslrdcfnlftkeeel
    esenapvcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsikkssvgvdfplqrlsl
    gdfasdkagspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsenqvasse
    gyvlfyqlmqepp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mtnC (C:)
    ghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggraqelteafadvigal
    whpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrsdddranlm
    wkryleredskivdlfvgqlksclkcqacgyrsttfevfcdlslpipkkgfgkvslrdcf
    nlftkeeelesenapvcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsikkssvgv
    dfplqrlslgdfasspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsenq
    vassegyvlfyqlm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mtnD (D:)
    gshmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls
    dyniqkwstlflllrlrggggggsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mtnD (D:)
    hmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkwstlflllrlrgg