PDB entry 3mtl

View 3mtl on RCSB PDB site
Description: Crystal structure of the PCTAIRE1 kinase in complex with Indirubin E804
Deposited on 2010-04-30, released 2010-06-09
The last revision was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00536 (1-End)
      • expression tag (0)
  • Heterogens: FEF, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mtlA (A:)
    metyikldklgegtyatvykgkskltdnlvalkeirleheegapctairevsllkdlkha
    nivtlhdiihteksltlvfeyldkdlkqylddcgniinmhnvklflfqllrglaychrqk
    vlhrdlkpqnllinergelkladfglaraksiptktydnevvtlwyrppdillgstdyst
    qidmwgvgcifyematgrplfpgstveeqlhfifrilgtpteetwpgilsneefktynyp
    kyraeallshaprldsdgadlltkllqfegrnrisaedamkhpfflslgerihklpdtts
    ifalkeiqlqkeaslrsahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mtlA (A:)
    metyikldklgegtyatvykgkskltdnlvalkeirlpctairevsllkdlkhanivtlh
    diihteksltlvfeyldkdlkqylddcgniinmhnvklflfqllrglaychrqkvlhrdl
    kpqnllinergelkladfglaraktlwyrppdillgstdystqidmwgvgcifyematgr
    plfpgstveeqlhfifrilgtpteetwpgilsneefktynypkyraeallshaprldsdg
    adlltkllqfegrnrisaedamkhpfflslgerihklpdttsifalkeiqlqke