PDB entry 3mtj

View 3mtj on RCSB PDB site
Description: the crystal structure of a homoserine dehydrogenase from thiobacillus denitrificans to 2.15a
Deposited on 2010-04-30, released 2010-05-12
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoserine dehydrogenase
    Species: Thiobacillus denitrificans [TaxId:292415]
    Gene: Tbd_0843
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3SKI5 (7-End)
      • expression tag (4-6)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mtjA (A:)
    enlyfqgmkpihvgllglgtvgggtltvlrrnaeeitrragreirvvraavrnldkaeal
    agglplttnpfdvvddpeidivveliggleparelvmqaiangkhvvtankhlvakygne
    ifaaaqakgvmvtfeaavaggipiikalregltanriewlagiingtsnfilsemrdkga
    afddvlkeaqrlgyaeadptfdiegidaahkltilsaiafgipmqferaytegisqltre
    dvryaeelgyrikllgiarraengielrvhptliperrlianvdgamnavlvkgdavgpt
    lyygagagseptasavvadlvdvtrlhtadphhrvphlafqpdqladtpilpmeavrtay
    ylrlrafdrpgvladitriladssisidamvqkepaegeeqvdiillthvtleknvnaai
    akiealdavagkvmrirledlgak
    

    Sequence, based on observed residues (ATOM records):
    >3mtjA (A:)
    fqgmkpihvgllglgtvgggtltvlrrnaeeitrragreirvvraavrnldkaealaggl
    plttnpfdvvddpeidivveliggleparelvmqaiangkhvvtankhlvakygneifaa
    aqakgvmvtfeaavaggipiikalregltanriewlagiingtsnfilsemrdkgaafdd
    vlkeaqrlgyaeadptfdiegidaahkltilsaiafgipmqferaytegisqltredvry
    aeelgyrikllgiarraengielrvhptliperrlianvdgamnavlvkgdavgptlyyg
    agagseptasavvadlvdvtrlhtadphhrvphlafqpdqladtpilpmeavrtayylrl
    rafrpgvladitriladssisidamvqkeqvdiillthvtleknvnaaiakiealdavag
    kvmrirledlg