PDB entry 3mti

View 3mti on RCSB PDB site
Description: the crystal structure of a rrna methylase from streptococcus thermophilus to 1.95a
Deposited on 2010-04-30, released 2010-05-12
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rRNA methylase
    Species: Streptococcus thermophilus [TaxId:264199]
    Gene: stu1645
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5M2Z6 (3-184)
      • expression tag (2)
  • Chain 'B':
    Compound: rRNA methylase
    Species: Streptococcus thermophilus [TaxId:264199]
    Gene: stu1645
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5M2Z6 (3-184)
      • expression tag (2)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mtiA (A:)
    snamikrpihmshdflaevlddesivvdatmgngndtaflaglskkvyafdvqeqalgkt
    sqrlsdlgientelildghenldhyvrepiraaifnlgylpsadksvitkphttleaiek
    ildrlevggrlaimiyyghdggdmekdavleyvigldqrvftamlyqplnqintppflvm
    leklq
    

    Sequence, based on observed residues (ATOM records):
    >3mtiA (A:)
    amikrpihmshdflaevlddesivvdatmgngndtaflaglskkvyafdvqeqalgktsq
    rlsdlgientelildghenldhyvrepiraaifnlgkphttleaiekildrlevggrlai
    miydmekdavleyvigldqrvftamlyqplnqintppflvmleklq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mtiB (B:)
    snamikrpihmshdflaevlddesivvdatmgngndtaflaglskkvyafdvqeqalgkt
    sqrlsdlgientelildghenldhyvrepiraaifnlgylpsadksvitkphttleaiek
    ildrlevggrlaimiyyghdggdmekdavleyvigldqrvftamlyqplnqintppflvm
    leklq
    

    Sequence, based on observed residues (ATOM records):
    >3mtiB (B:)
    amikrpihmshdflaevlddesivvdatmgngndtaflaglskkvyafdvqeqalgktsq
    rlsdlgientelildghenldhyvrepiraaifnlgylpsadkskphttleaiekildrl
    evggrlaimiyyghdggdmekdavleyvigldqrvftamlyqplnqintppflvmleklq