PDB entry 3mth
View 3mth on RCSB PDB site
Description: x-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben and phenol
Class: hormone
Keywords: hormone
Deposited on
1995-09-13, released
1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: methylparaben insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3mth.1 - Chain 'B':
Compound: methylparaben insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3mth.1 - Chain 'C':
Compound: methylparaben insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3mth.2 - Chain 'D':
Compound: methylparaben insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3mth.2 - Heterogens: ZN, CL, MPB, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3mthA (A:)
giveqcctsicslyqlenycn
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3mthB (B:)
fvnqhlcgshlvealylvcgergffytpka
Sequence, based on observed residues (ATOM records): (download)
>3mthB (B:)
vnqhlcgshlvealylvcgergffytpk
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3mthC (C:)
giveqcctsicslyqlenycn
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3mthD (D:)
fvnqhlcgshlvealylvcgergffytpka