PDB entry 3mth

View 3mth on RCSB PDB site
Description: x-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben and phenol
Class: hormone
Keywords: hormone
Deposited on 1995-09-13, released 1996-01-29
The last revision prior to the SCOP 1.73 freeze date was dated 1996-01-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1843
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: methylparaben insulin
  Species: SUS SCROFA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOP 1.73: d3mth.1
• Chain 'B':
  Compound: methylparaben insulin
  Species: SUS SCROFA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315
  Domains in SCOP 1.73: d3mth.1
• Chain 'C':
  Compound: methylparaben insulin
  Species: SUS SCROFA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOP 1.73: d3mth.2
• Chain 'D':
  Compound: methylparaben insulin
  Species: SUS SCROFA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOP 1.73: d3mth.2
• Heterogens: ZN, CL, MPB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mthA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3mthB (B:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3mthB (B:)
  vnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mthC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mthD (D:)
  fvnqhlcgshlvealylvcgergffytpka