PDB entry 3mth

View 3mth on RCSB PDB site
Description: x-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben and phenol
Deposited on 1995-09-13, released 1996-01-29
The last revision prior to the SCOP 1.55 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1843
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3mth.1
  • Chain 'B':
    Domains in SCOP 1.55: d3mth.1
  • Chain 'C':
    Domains in SCOP 1.55: d3mth.2
  • Chain 'D':
    Domains in SCOP 1.55: d3mth.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mthA (A:)
giveqcctsicslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mthB (B:)
vnqhlcgshlvealylvcgergffytpk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mthC (C:)
giveqcctsicslyqlenycn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mthD (D:)
fvnqhlcgshlvealylvcgergffytpka