PDB entry 3mtg

View 3mtg on RCSB PDB site
Description: Crystal structure of human S-adenosyl homocysteine hydrolase-like 1 protein
Deposited on 2010-04-30, released 2010-05-26
The last revision was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative adenosylhomocysteinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: AHCYL1, DCAL, Irbit, XPVKONA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43865 (Start-443)
      • engineered mutation (421)
  • Chain 'B':
    Compound: Putative adenosylhomocysteinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: AHCYL1, DCAL, Irbit, XPVKONA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43865 (Start-443)
      • engineered mutation (421)
  • Heterogens: NAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mtgA (A:)
    smvsprekqqtnskgssnfcvknikqaefgrreieiaeqdmsalislrkraqgekplaga
    kivgcthitaqtavlietlcalgaqcrwsacniystqnevaaalaeagvavfawkgesed
    dfwwcidrcvnmdgwqanmilddggdlthwvykkypnvfkkirgiveesvtgvhrlyqls
    kagklcvpamnvndsvtkqkfdnlyccresildglkrttdvmfggkqvvvcgygevgkgc
    caalkalgaivyiteidpicalqacmdgfrvvklnevirqvdvvitctgnknvvtrehld
    rmknscivcnmghsnteidvtslrtpeltwervrsqvdhviwpdgkrvvllaegrllnls
    cstvptfvlsitattqalalielynapegrykqdvyllpkkmdeyvaslhlpsfdahlte
    laddqakylglnkngpfkpnyyry
    

    Sequence, based on observed residues (ATOM records):
    >3mtgA (A:)
    gssnfcvknikqaefgrreieiaeqdmsalislrkraqgekplagakivgcthitaqtav
    lietlcalgaqcrwsacniystqnevaaalaeagvavfawkgeseddfwwcidrcvnmdg
    wqanmilddggdlthwvykkypnvfkkirgiveesvtgvhrlyqlskagklcvpamnvnd
    svtkqkfdnlyccresildglkrttdvmfggkqvvvcgygevgkgccaalkalgaivyit
    eidpicalqacmdgfrvvklnevirqvdvvitctgnknvvtrehldrmknscivcnmghs
    nteidvtslrtpeltwervrsqvdhviwpdgkrvvllaegrllnlscstvptfvlsitat
    tqalalielynapegrykqdvyllpkkmdeyvaslhlpsfdahlteladdqakylglnkn
    gpfkpnyyry
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mtgB (B:)
    smvsprekqqtnskgssnfcvknikqaefgrreieiaeqdmsalislrkraqgekplaga
    kivgcthitaqtavlietlcalgaqcrwsacniystqnevaaalaeagvavfawkgesed
    dfwwcidrcvnmdgwqanmilddggdlthwvykkypnvfkkirgiveesvtgvhrlyqls
    kagklcvpamnvndsvtkqkfdnlyccresildglkrttdvmfggkqvvvcgygevgkgc
    caalkalgaivyiteidpicalqacmdgfrvvklnevirqvdvvitctgnknvvtrehld
    rmknscivcnmghsnteidvtslrtpeltwervrsqvdhviwpdgkrvvllaegrllnls
    cstvptfvlsitattqalalielynapegrykqdvyllpkkmdeyvaslhlpsfdahlte
    laddqakylglnkngpfkpnyyry
    

    Sequence, based on observed residues (ATOM records):
    >3mtgB (B:)
    gssnfcvknikqaefgrreieiaeqdmsalislrkraqgekplagakivgcthitaqtav
    lietlcalgaqcrwsacniystqnevaaalaeagvavfawkgeseddfwwcidrcvnmqa
    nmilddggdlthwvykkypnvfkkirgiveesvtgvhrlyqlskagklcvpamnvndsvt
    kqkfdnlyccresildglkrttdvmfggkqvvvcgygevgkgccaalkalgaivyiteid
    picalqacmdgfrvvklnevirqvdvvitctgnknvvtrehldrmknscivcnmghsnte
    idvtslrtpeltwervrsqvdhviwpdgkrvvllaegrllntvptfvlsitattqalali
    elynapegrykqdvyllpkkmdeyvaslhlpsfdahlteladdqakylglnkngpfkpny
    yry