PDB entry 3mtf

View 3mtf on RCSB PDB site
Description: Crystal structure of the ACVR1 kinase in complex with a 2-aminopyridine inhibitor
Class: transferase
Keywords: Protein Kinase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2010-04-30, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.185
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVR1, ACVRLK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04771
      • engineered mutation (8)
    Domains in SCOPe 2.07: d3mtfa_
  • Chain 'B':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVR1, ACVRLK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04771 (Start-300)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d3mtfb_
  • Heterogens: PO4, EDO, A3F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mtfA (A:)
    smqrtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlr
    henilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglah
    lhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgt
    krymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpnd
    psfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mtfA (A:)
    tvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrheni
    lgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhie
    ifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkrym
    apevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsfe
    dmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mtfB (B:)
    smqrtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlr
    henilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglah
    lhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgt
    krymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpnd
    psfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mtfB (B:)
    rtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrhen
    ilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhi
    eifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkry
    mapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsf
    edmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltkid